PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG274400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 563aa    MW: 63012.9 Da    PI: 4.7197
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG274400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.55.6e-1281935622374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cAea+s+ +  +aq+++a+l++ ++ +gdp qR+aay++e+Laa++++s++++y+al+++e++   +  +l+a+++++e++P++
  Pavir.9NG274400.1.p 193 KQLLFDCAEAISEYNVDEAQSIIAELRQKVAIQGDPSQRIAAYLVEGLAATIQSSGKGIYRALRCKEAP---TLYQLSAMQILFEICPCF 279
                          589*****************************************************************9...89999************* PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          ++++++aN aIlea +gee vHiiDfdi+qG Q+++L+q L + +++p  lRiTgv++pes+      l+ +g+rL+k+Ae +gvpfef+
  Pavir.9NG274400.1.p 280 RLGFMAANYAILEACKGEEVVHIIDFDINQGSQYITLIQFLRNNSNKPRLLRITGVDDPESVnrAVGGLKVVGQRLEKLAEDCGVPFEFR 369
                          ************************************************************99888899********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + va+++ed+++ +L+++pgEal+Vn+++ lh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++Fl+rf e  +yysalfd
  Pavir.9NG274400.1.p 370 A-VASNIEDVTPGMLDCRPGEALIVNFAFLLHHLPDESVSMVNERDQLLRMVKGLRPKLVTLVEQNANTNTTPFLARFREVYDYYSALFD 458
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          sl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+rl++aGF p p+++++ + +k+ll+ + +  yr e+ ++ l 
  Pavir.9NG274400.1.p 459 SLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARLTMAGFVPSPFNTNVIDGIKSLLKSYCD-KYRFEKVHDGLH 547
                          ***************************************************************************95.5*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gW d++Lv+ SaW+
  Pavir.9NG274400.1.p 548 FGWGDKTLVVSSAWQ 562
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.243166543IPR005202Transcription factor GRAS
PfamPF035141.9E-125193562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSFIRQADPS ASCAETPYIH KFDPPGSVFP AQRFASGKEL LHHGPQPYKS EGYRQSGFNG  60
TAAHVFQNSF YNTDSHVECH FNEATCSPTI SNVSQQNSQS LSDNQTSDLE VEFDGDEMRL  120
KLQELEHALL DDGDEIFSDL LGIIDDEWND NMKNNDWTNT MKNIRSLDSP KESSPESSLC  180
CPDSNNGEAR PPKQLLFDCA EAISEYNVDE AQSIIAELRQ KVAIQGDPSQ RIAAYLVEGL  240
AATIQSSGKG IYRALRCKEA PTLYQLSAMQ ILFEICPCFR LGFMAANYAI LEACKGEEVV  300
HIIDFDINQG SQYITLIQFL RNNSNKPRLL RITGVDDPES VNRAVGGLKV VGQRLEKLAE  360
DCGVPFEFRA VASNIEDVTP GMLDCRPGEA LIVNFAFLLH HLPDESVSMV NERDQLLRMV  420
KGLRPKLVTL VEQNANTNTT PFLARFREVY DYYSALFDSL DATLPRESPD RMNVERQCLA  480
REIVNILACE GPDRVERYEV AGKWRARLTM AGFVPSPFNT NVIDGIKSLL KSYCDKYRFE  540
KVHDGLHFGW GDKTLVVSSA WQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-471915623375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.167430.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962026.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK3Z5170.0K3Z517_SETIT; Uncharacterized protein
STRINGSi021635m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1